Phosl lectin
WebOct 29, 2015 · We earlier reported the purification of a mitogenic lectin from human pathogenic fungus Cephalosporium curvulum (CSL) that has complex sugar specificity when analysed by hapten inhibition assay. In the present study, we report the fine sugar specificity of CSL as determined by glycan array analysis. WebMay 17, 2024 · This lectin showed an extreme stability against heat treatment, e.g., 100 °C for 30 min, and also against incubation at pH 2–11. PhoSL is therefore suitable for its use …
Phosl lectin
Did you know?
WebJul 31, 2014 · Taken together, PhoSL is the most suitable lectin for recognizing core fucose and might play a pivotal role in the future of fucosylation-biology. Figure & Legends Figure & Legends Fig. 1. Immunohistochemical staining of PhoSL in the original cancer tissue. Left panel: positive staining of AAL in the original colorectal cancer tissues.
WebJan 30, 2016 · Fucosylation levels of AGP using AAL and PhoSL lectins. Fucosylation levels of AGP were analysed with an enzyme-linked lectin assay (ELLA) using A. aurantia lectin (AAL) which recognizes fucoses α1-2, α1-3 or α1-6-linked [7] and with P. squarrosa lectin (PhoSL) which recognizes only α1-6-linked fucose [24]. Both assays were optimized with ... WebEstablishment of a novel lectin–antibody ELISA system to determine core-fucosylated haptoglobin. Author links open overlay panel Mayuka Shimomura a 1, Kotarosumitomo Nakayama a 1, Kanako Azuma a, Naoko Terao a, Kimihiro Nishino a, Shinji Takamatsu a, Miyako Nakano b, Shiro Takahashi b, Yuka Kobayashi c, Kohei Murata d, Yoshihiro …
WebALC offers the broadest, most versatile line of lecithin-based products on the market. Under the world-famous ALCOLEC® trademark, American Lecithin markets a series of natural … WebThe BLAST search revealed that PhoSL has 85% sequence homology (22/26 amino acids) with the ␣ 1– 6-linked fucose- specific lectin from R. stolonifer . RSL has also been isolated as a core...
WebAug 25, 2024 · Here, we observed that the S proteins of the ancestral (Wuhan) and Omicron strains bind with Pholiota squarrosa lectin (PhoSL), a 40-amino-acid chemically synthesised peptide specific to core-fucosylated N-glycans. The affinities were at a low nanomolar level, which were ~ 1000-fold stronger than those between PhoSL and the core-fucosylated N ...
WebJul 6, 2024 · The lectin from a mushroom Pholiota squarrosa (PhoSL) shows a clear specificity to core fucosylation, without recognizing those with other types of … diary of worm spider and flyWebOct 30, 2024 · To investigate functional loss by FUT8 gene ablation, lectin binding was tested using a lectin from the mushroom Pholiota squarrosa (PhoSL), which shows a specific binding property for core ... cities to visit in europe in februaryWebMay 17, 2024 · The core α1–6 fucosylation-specific lectin from a mushroom Pholiota squarrosa (PhoSL) is a potential tool for precise diagnosis of cancers. This lectin consists of only 40 amino acids and can be chemically synthesized. We showed here that a synthesized PhoSL peptide formed a trimer by gel filtration and chemical cross-linking assays, and … cities to visit in england top 10WebFeb 27, 2024 · RCSB PDB - 6JK2: Crystal structure of a mini fungal lectin, PhoSL. Biological Assembly 1. 3D View : Structure 1D-3D View Electron Density Validation Report … diary of zenas brettWebSep 28, 2024 · To achieve the cure, new anti-HBV agents are needed. Here we found that Pholiota squarrosa lectin (PhoSL), a lectin that specifically binds core-fucose, inhibited … cities to visit in belgiumWebOct 5, 2012 · The purified lectin was designated as PhoSL ( P. squarrosa lectin). SDS-PAGE, MALDI-TOF mass spectrometry, and N-terminal amino acid sequencing indicate that PhoSL has a molecular mass of 4.5 kDa and consists of 40 amino acids (NH 2 -APVPVTKLVCDGDTYKCTAYLDFGDGRWVAQWDTNVFHTG-OH). Isoelectric focusing of … diary on flipkartWebStructural modelling of the PhoSL-S protein complex indicated that PhoSL was in contact with the amino acids of the S protein, which explains the enhanced affinity with S protein … cities to visit in europe in september